Tools
Sorted by:
Try your query at:
 |
 |
 |
 |
 |
 |
Results 1 - 10
of
2,179
Preparation of Immunoglobulin Y from Egg Yolk Using Ammonium Sulfate Precipitation and Ion Exchange Chromatography
"... ABSTRACT The objective of this study was to develop an economical, simple, and large-scale separationmethod for IgY from egg yolk. Egg yolk diluted with 9 volumes of cold water was centrifuged after adjusting the pH to 5.0. The supernatant was added with 0.01 % charcoal or 0.01 % carrageenan and cen ..."
Abstract
-
Cited by 5 (0 self)
- Add to MetaCart
and centrifuged at 2,800 × g for 30 min. The supernatant was filtered through a Whatman no. 1 filter paper and then the filtrate was concentrated to 20 % original volume using ultrafiltration. The concen-trated solution was further purified using either cation exchange chromatography or ammonium sulfate precipi-tation
An Inhibitor of the dPKC Interaction with the d Subunit of F1Fo ATP Synthase Reduces Cardiac Troponin I Release from Ischemic Rat Hearts: Utility of a Novel Ammonium Sulfate Precipitation Technique
"... We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted dPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSF-DYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrat ..."
Abstract
- Add to MetaCart
demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic
Article Partial Purification and Characterization of Halotolerant Alkaline Protease from Halomonas marisflava KCCM 10457 Isolated from Salt-fermented Food Man-Jin In*, Nam-Soon Oh
, 2005
"... Halotolerant protease produced by Halomonas marisflava KCCM 10457 was partially purified through ammonium sulfate precipitation and Sephacryl S-200HR gel permeation chromatography. Optimal pH and temperature of protease were 11.0 and 45 o C, respectively. Enzyme activity was inhibited by Cu ..."
Abstract
- Add to MetaCart
Halotolerant protease produced by Halomonas marisflava KCCM 10457 was partially purified through ammonium sulfate precipitation and Sephacryl S-200HR gel permeation chromatography. Optimal pH and temperature of protease were 11.0 and 45 o C, respectively. Enzyme activity was inhibited by Cu
EXTRACTION, PURIFICATION AND CHARACTERIZATION OF LECTIN FROM PHASEOLUS VULGARIS L. CV. WHITE SEEDS (WHITE KIDNEY BEAN)
"... Abstract The purpose of the research was to study the purification and characterization of lectin from Phaseolus vulgaris L. cv.white seeds. The lectin was purified by sequence of steps , namly , first with ammonium sulfate precipitation followed by ion exchange (DEAE cellulose) and gel filtration ..."
Abstract
- Add to MetaCart
Abstract The purpose of the research was to study the purification and characterization of lectin from Phaseolus vulgaris L. cv.white seeds. The lectin was purified by sequence of steps , namly , first with ammonium sulfate precipitation followed by ion exchange (DEAE cellulose) and gel filtration
BSA = Bovine Serum Albumin
"... Synthetic malondialdehyde conjugated to bovine serum albumin Specificity and Preparation: Antiserum previously preabsorbed on protein carriers and purified by ammonium sulfate precipitation. This antibody targets conjugated malondialdehyde. This antibody does not recognize free malondialdehyde. Usin ..."
Abstract
- Add to MetaCart
Synthetic malondialdehyde conjugated to bovine serum albumin Specificity and Preparation: Antiserum previously preabsorbed on protein carriers and purified by ammonium sulfate precipitation. This antibody targets conjugated malondialdehyde. This antibody does not recognize free malondialdehyde
A critical evaluation of simple methods for the estimation of free testosterone in serum. J Clin Endocrinol Metab
, 1999
"... The free and nonspecifically bound plasma hormone levels gener-ally reflect the clinical situation more accurately than total plasma hormone levels. Hence, it is important to have reliable indexes of these fractions. The apparent free testosterone (T) concentration obtained by equilibrium dialysis ( ..."
Abstract
-
Cited by 273 (0 self)
- Add to MetaCart
(AFTC) as well as the fraction of serum T not precipitated by 50 % ammonium sulfate concentration (non-SHBG-T; SHBG, sex hormone-binding globulin), often referred to as bioavail-able T, appear to represent reliable indexes of biologically readily available T, but are not well suited for clinical routine
Ammonium Alunite and Basic Aluminum Sulfate: Effect of Precipitant Agent
, 2015
"... Abstract: Ammonium bisulfite as a precipitating agent was used to synthesize basic aluminum sulfate (BAS) by homogeneous precipitation. Aluminum sulfate in aqueous solution was used as the raw material. High concentration of the precipitant agent promotes the formation of ammonium alunite, which was ..."
Abstract
- Add to MetaCart
Abstract: Ammonium bisulfite as a precipitating agent was used to synthesize basic aluminum sulfate (BAS) by homogeneous precipitation. Aluminum sulfate in aqueous solution was used as the raw material. High concentration of the precipitant agent promotes the formation of ammonium alunite, which
Research Article Isolation and Partial Characterization of Antifungal Protein from Bacillus subtilis
"... Bacillus subtilis was isolated and identified from soil samples of The Nilgiris district of Tamilnadu. From B.subtilis antifungal protein was precipitated by using ammonium sulfate precipitation method and desalted by using desalting column. Desalted protein was screened for antifungal activity agai ..."
Abstract
- Add to MetaCart
Bacillus subtilis was isolated and identified from soil samples of The Nilgiris district of Tamilnadu. From B.subtilis antifungal protein was precipitated by using ammonium sulfate precipitation method and desalted by using desalting column. Desalted protein was screened for antifungal activity
Purification and characterization of cell-envelopeproteinase from Lactobacillus casei DI-1
, 2012
"... -free method, the cell-envelope proteinase (CEP) of Lactobacillus casei DI-1 isolated from duck small intestine was released from cells and purified by ammonium sulfate precipitation, and by diethylaminoethyl (DEAE)-Sephadex A-25 and Sephadex G-100 gel chromatography. The purified CEP had a monomer ..."
Abstract
- Add to MetaCart
-free method, the cell-envelope proteinase (CEP) of Lactobacillus casei DI-1 isolated from duck small intestine was released from cells and purified by ammonium sulfate precipitation, and by diethylaminoethyl (DEAE)-Sephadex A-25 and Sephadex G-100 gel chromatography. The purified CEP had a monomer
Characterization of a Heat Stable -Amylase from a Thermophilic Actinobacteria, Streptomyces sp. MSC702
"... A partial purification and biochemical characterization of the -amylase from Streptomyces sp. MSC702 were carried out in this study. The optimum operational conditions for enzyme substrate reaction for amylolytic enzyme activity from the strain were evaluated. The optimum pH, temperature, and incub ..."
Abstract
- Add to MetaCart
, and incubation period for assaying the enzyme were observed to be 5.0, 55 ∘ C, and 30 min, respectively. The extracellular extract was concentrated using ammonium sulfate precipitation. It was stable in the presence of metal ions
Results 1 - 10
of
2,179
